PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa18g012440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 312aa    MW: 34817.5 Da    PI: 9.815
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa18g012440.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind332.51.1e-10113121274
       GAGA_bind   1 mdddgsre..rnkgyye....pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllve 88 
                     mdd g+re  r+k+       ++ +s+     +q+ms+iaerda+i+ernla+sekkaa+aerdmaflqrd+a+aern+a++erd++l+al+++e
  Csa18g012440.1   1 MDDGGHREngRHKAAPGqwmmQHqPSM-----KQVMSIIAERDAAIQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAIMERDSALTALQYRE 90 
                     999999877777762221112222344.....5************************************************************** PP

       GAGA_bind  89 nsla.....salpvgvqvlsgtksidslqqlse......pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkkse 172
                     ns++     +++++g+q+++g+k++++ +++++      pql+++a+e+re+e ++ l+++  a +a e++k+k+++r k+pk++++++++k+++
  Csa18g012440.1  91 NSMVtaaaaNMSAPGCQMSRGVKHMHHPHMHHHhqqhhiPQLTENAYETREMEPNDGLQTSPPAGSALESAKPKRGKRVKDPKATTQTAANKRGP 185
                     **999998888899**************9976679999********************************************************* PP

       GAGA_bind 173 kskkkvkkesader........................skaekksidl.vlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvy 242
                     k+++kvkkes+d+                         sk+++ks+++ +ln+v +De+t+P+PvCsCtG+lrqCYkWGnGGWqS+CCttt+S+y
  Csa18g012440.1 186 KNQRKVKKESEDDLtkimfvktthdyteedsskhiligSKSDWKSQEMvGLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMY 280
                     **********984358********************************88********************************************* PP

       GAGA_bind 243 PLPvstkrrgaRiagrKmSqgafkklLekLaa 274
                     PLP+ +++r+aR++grKmS++af+klL++Laa
  Csa18g012440.1 281 PLPALPNKRHARVGGRKMSGSAFNKLLSRLAA 312
                     ******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062173.0E-821312IPR010409GAGA-binding transcriptional activator
SMARTSM012268.8E-1411312IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDDGGHRENG RHKAAPGQWM MQHQPSMKQV MSIIAERDAA IQERNLAISE KKAAIAERDM  60
AFLQRDTAIA ERNNAIMERD SALTALQYRE NSMVTAAAAN MSAPGCQMSR GVKHMHHPHM  120
HHHHQQHHIP QLTENAYETR EMEPNDGLQT SPPAGSALES AKPKRGKRVK DPKATTQTAA  180
NKRGPKNQRK VKKESEDDLT KIMFVKTTHD YTEEDSSKHI LIGSKSDWKS QEMVGLNQVV  240
YDETTMPPPV CSCTGVLRQC YKWGNGGWQS SCCTTTLSMY PLPALPNKRH ARVGGRKMSG  300
SAFNKLLSRL AA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2217520.0AK221752.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL21-54-A10.
GenBankAK2272460.0AK227246.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL11-01-O04.
GenBankAY0885640.0AY088564.1 Arabidopsis thaliana clone 7878 mRNA, complete sequence.
GenBankAY3805720.0AY380572.1 Arabidopsis thaliana basic pentacysteine 6 (BPC6) mRNA, complete cds.
GenBankBT0248740.0BT024874.1 Arabidopsis thaliana At5g42520 mRNA, complete cds.
GenBankEF1231080.0EF123108.1 Arabidopsis thaliana GAGA-binding transcriptional activator (BBR/BPC6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010481981.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1
RefseqXP_010481982.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2
SwissprotQ8L9990.0BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLR0GAL80.0R0GAL8_9BRAS; Uncharacterized protein
STRINGAT5G42520.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61692647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.10.0basic pentacysteine 6